PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000781-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 481aa    MW: 53670.9 Da    PI: 6.5653
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000781-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.4e-142569348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      WT++Ed++l + +  +G+++W+ Ia+++   +t  qc+ rw++yl
    NNU_000781-RA 25 TWTQQEDDILREQISIHGTENWSIIAAKFK-DKTTRQCRRRWYTYL 69
                     6****************************9.*************97 PP

2Myb_DNA-binding43.29.4e-1475118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W++eEd +l +a k +G++ W+ Ia+ +  gRt++ +k+r+ +
    NNU_000781-RA  75 KGGWSPEEDMILCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 118
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8591869IPR017930Myb domain
SuperFamilySSF466891.05E-2522116IPR009057Homeodomain-like
SMARTSM007175.4E-132271IPR001005SANT/Myb domain
CDDcd001671.68E-122569No hitNo description
PfamPF139214.8E-142684No hitNo description
Gene3DG3DSA:1.10.10.607.1E-202678IPR009057Homeodomain-like
PROSITE profilePS5129419.93870124IPR017930Myb domain
SMARTSM007171.6E-1474122IPR001005SANT/Myb domain
CDDcd001671.83E-1078119No hitNo description
Gene3DG3DSA:1.10.10.608.6E-1979123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MKLHETPKAE SATTITKPKE RHIVTWTQQE DDILREQISI HGTENWSIIA AKFKDKTTRQ  60
CRRRWYTYLN SECKKGGWSP EEDMILCEAQ KIFGNRWTEI AKVVSGRTDN AVKNRFSTLC  120
KKRAKHEALS KENNASYINP NNKRVIFQNG LVLGDESAES AAPLKRMRTH ISSLTEDNTT  180
KGEITKECAK TEHQQIRPPF AVLIQNFHNA GELQSQQHVG NNTHTASKYV ANNEVQGTFL  240
KRDDPKIAAL MQQAELLSSL ALKVNTENTN QSLENAWKEL QEFLSRTKEG DFDTYKISEV  300
DFLTEDFKNL VEDLKSSNMG NELSWRQPNL YESPGSSEYS TGSTAQSHAS GDKTEQPQVE  360
VCSLHQDGSV VSMPIHAEVR NGGDGCEDGI CVSTAQGTFL SCDEPKGNEE VVSALFHTEF  420
SSPLQVIPLF RSLAAGIPSP KFSESERNFL LKTLGTDSPI SGPGTSTSHP PPCRRALLHS  480
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-282612410108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256812.10.0PREDICTED: myb-related protein A
TrEMBLD7TNB90.0D7TNB9_VITVI; Putative uncharacterized protein
STRINGVIT_01s0026g01910.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14350.21e-161MYB family protein